DPCstruct | MC7365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 59.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5QN91 | 7-73 | VTVPAQTSFTKYIPLEGNRSNLVQTSWAMMGLIHAGQMERDPTPLHRASKLLINSQLEDGDFPQQRV |
| A0A835E2I1 | 493-545 | TNLKGKRAHAVNTGWAMLALIDAGQTERDPTPLHRAAKVLINLQSEDGEFPQQ |
| A0A0D3C1E0 | 395-451 | None |
| A0A453RGS7 | 2-62 | None |
| A0A0A0LPS4 | 1-67 | None |
| A0A368PZ09 | 22-76 | None |
| A0A078FAL4 | 110-168 | None |
| A0A835J6N0 | 382-447 | None |
| A0A6V7Q980 | 166-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.