DPCstruct | MC7361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 5.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1WHT1 | 1-67 | MYSFVRPSKYRHVYGTASKREGCYESLRISLGAWDTNFVTANPKYVAANWDAGGGGAFCVVPLSQVG |
| T1G7N8 | 1-65 | MFGIRSSKFRHLYGCVSRKEDCYEGVKVTSNAHDSNFCEVNPKFVAIVIESIGGGVFIVIPINQV |
| A0A7M4DXD3 | 45-112 | None |
| A0A1I7WW12 | 4-92 | None |
| A0A1A6HNI7 | 33-100 | None |
| A0A0R3RGK8 | 3-68 | None |
| A0A804HLC9 | 4-73 | None |
| A0A2J8TMV5 | 1-68 | None |
| M7BYI7 | 1-73 | None |
| A0A183STW8 | 3-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.