DPCstruct | MC7360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 56 ± 3 aa |
| Standard deviation of domain lengths | 2.85 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 73.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8H5C2 | 3-53 | EWVEIIEPRTHEHMFANLSTGECLWDPPVGVAVKKTSADQWWELFDQNTAR |
| A0A814KPV4 | 2-56 | CERLEWVEIIEPKSKDRMYANLITGECVWQPPPSAKIKLQNHTQWWELYDNSTKR |
| A0A6H5IIZ0 | 13-67 | None |
| A0A7J7JHF0 | 37-89 | None |
| A0A820SRF2 | 2-56 | None |
| S4RIL2 | 26-76 | None |
| A0A2R7W0Z2 | 1-57 | None |
| T1J9E4 | 2-57 | None |
| A0A0T6B7S7 | 1-59 | None |
| C3Z6J8 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.