DPCstruct | MC736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413VS53 | 38-141 | DDNLLLNEIESTYLNRIFEATRKDFDFTNKKVAFLTGSLGKTMSSKEHYFDMHEKHSTNANYPCDNGTLYTFNAVQKSESDGYDAAI… |
| A0A3P1YDS1 | 18-136 | DSVLNNINKMGIDDNPLLTELEGEYFNALYQVPDKEFNLSGKKVAFFTGSLGKTESNKVRYFIIERDRLECNYSPSIGILYIFNAQQ… |
| U2JZC9 | 17-131 | None |
| A0A125S446 | 224-331 | None |
| A0A090WX77 | 56-175 | None |
| A0A4U9U9S6 | 18-131 | None |
| A0A370EQ35 | 18-128 | None |
| A0A644SPX4 | 95-213 | None |
| A0A0A2F6G4 | 12-129 | None |
| A0A090VH02 | 3-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.