DPCstruct | MC7357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 116 ± 21 aa |
| Standard deviation of domain lengths | 20.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF19334- PF13271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803SVV2 | 16-123 | SALRRAAFSGNLSALPSHLAPSGRSVRVFVSTNPEDTVAERSALREHIYPKLREFCRENYGLEFQVIDLYWGVEPEEWHSPELQKTR… |
| T1G5K2 | 13-138 | RDRADEDDVIDGSVLSLAQDKSQIIRVFISSTFSDTCSERNILMEKAYPRLKDYCRQYDLEFQAYDLRWGIRDVSHDDHSIVDFCLR… |
| A0A1V1P0Z7 | 8-110 | None |
| A0A813M8I0 | 3-110 | None |
| A0A4Y2AA01 | 10-114 | None |
| A0A816QJE4 | 4-109 | None |
| A0A7M7HPJ9 | 216-379 | None |
| A0A6J8DP08 | 260-394 | None |
| A0A182TQR7 | 8-104 | None |
| A0A3S0U1E6 | 5-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.