DPCstruct | MC7356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 73 ± 10 aa |
| Standard deviation of domain lengths | 10.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448XLE4 | 2-59 | GMISGAIADWQITASSTYPATWQQGCSEGNARLYRPNGLAWCAKFKSSSEWLQIDLGV |
| T1G403 | 1-77 | THTLHTTECSYNTPLGMSTDEIHDSQLSSSSNYPHNWDKGCHLKFARIYQANGLAWCAKYKSSSEWLQIDLGVPAKV |
| A0A2B4S359 | 152-237 | None |
| C3ZNH7 | 156-206 | None |
| A0A8B6CD36 | 447-512 | None |
| A0A6P4Y5I2 | 16-88 | None |
| A7S5M9 | 462-537 | None |
| A7RXG2 | 37-121 | None |
| A0A2B4R7I8 | 135-193 | None |
| A0A2B4RC24 | 407-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.