DPCstruct | MC7355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 221 |
|---|---|
| Mean domain length (aa) | 157 ± 24 aa |
| Standard deviation of domain lengths | 24.31 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.78 |
| Pfam Score | 98.66 |
| Assigned Pfam label(s) | PF19292- PF10162- PF15711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3GTX4 | 208-350 | QSPVNIAVHAFDQAFITLTDASGNPTDASFGRRGYNVTLLDEKTGRVLDEQGFDTVANGYEVERLVSYLDQLPAGRIVILATREGAG… |
| T1G1W2 | 11-143 | HFPVRMYTGKKNTELPKICFKGRYVVAQDLNDAGRGVIVVVVNIESGAILNVKRFDTYENSAKLVNLLKLVSSSEFIIAIAHDEAQT… |
| F4PLS0 | 464-591 | None |
| F4PSK8 | 617-791 | None |
| F4PWM3 | 344-497 | None |
| F4PWM4 | 394-504 | None |
| F4PZ51 | 328-529 | None |
| A0A7M5TZM1 | 27-205 | None |
| A0A3B5R847 | 54-214 | None |
| A0A0N5CQH7 | 89-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.