DPCstruct | MC7352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 377 ± 21 aa |
| Standard deviation of domain lengths | 20.66 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174ITK9 | 9-327 | LNRWNEEEEYQKIIEAVEALPEEEKTPVLISEMACAYNNLAEADDSRLFEKAAELLESVEEELSADHRWNFRMGYACYYLNREKKAK… |
| B6FXM7 | 1-387 | MDFKMLLEKCQIWNEDGNYAKIIEELEKIPYENRTPETDSELARAYANIAEPSDRELFKKAIDLLVPHEEYFEGDHCWNFRMAYAYY… |
| A0A1Y4TLY2 | 1-384 | None |
| A0A139K6M5 | 405-786 | None |
| A0A1E3AZU3 | 445-832 | None |
| A0A2X0WU19 | 4-384 | None |
| A0A0L6JKJ0 | 1-375 | None |
| A0A3D5KXZ3 | 1-389 | None |
| A6NUL8 | 287-681 | None |
| A0A1Y3XRP7 | 573-938 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.