DPCstruct | MC7351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 23.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07873 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4EN63 | 2-66 | STYMEVKGNREVVLEGCRGVLEYDTDVVRVRAGRMTLRFTGRCLVIRCLTADSLVVEGFITGIEF |
| R5SPG1 | 39-112 | QEILKKTTKITIVHNDSVLIEGYEKIIDYLENYIKIRCRSLEIIIDGKMLDIKEMTTEDLVVTGEIYSVNYKKV |
| A0A5D3I204 | 18-99 | None |
| A0A1V5GDS8 | 5-88 | None |
| K6Q1W2 | 29-117 | None |
| A0A316T6E4 | 55-140 | None |
| A0A3R6QNN4 | 23-102 | None |
| A5D644 | 5-82 | None |
| A0A3D2CKT7 | 75-144 | None |
| D4LCN7 | 6-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.