DPCstruct | MC735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 181 ± 20 aa |
| Standard deviation of domain lengths | 19.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11644 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6HNI7 | 26-208 | KNIKDIWTTMPDSMIVYMDKKARMECIDLIEKGMTPEITNRLGGKTRIDTITSDFISATLSEASNIQIKLLPAVNDTIICYIHTYKG… |
| A0A2A6E6L3 | 12-211 | ACTIVGVGAQDMAELFVKMPDEYTIGLEDAWRKDLVNLYRAGKEAKLQNMMQGASQLMKLTPDYLKIQTSGRSTVELRRLPLVNHTW… |
| A1ZKK2 | 49-244 | None |
| A0A257B7S8 | 7-190 | None |
| R6YFY4 | 267-457 | None |
| F3LQQ5 | 167-299 | None |
| A0A1G6JT20 | 35-218 | None |
| A0A5P8E735 | 36-217 | None |
| E8U7W4 | 12-222 | None |
| U2J1G7 | 2-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.