DPCstruct | MC7349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 243 ± 22 aa |
| Standard deviation of domain lengths | 22.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A269PSD5 | 5-271 | KSYFQMKWLFILTISMCLIVIVYLLNQKVIEQTQIQRLADKLVKQQPDKSLQQTSNVTKINLSNIELPAPPKIKRGRSQLNQNKPNN… |
| A0A2E4XXE4 | 100-343 | QKVAALKPTSETLPPQKSTKVKPLKPTDIPQAEPADAEIAVADEKKSSRREAETKIAPQPANAMAQKKAPTVGRNQTSPLIAVGRPL… |
| A0A7V1F8R4 | 49-307 | None |
| A0A2E5V3R9 | 1-241 | None |
| A8TZZ9 | 24-273 | None |
| A0A3D9HVY9 | 153-427 | None |
| A0A1Z7YXG4 | 7-223 | None |
| A0A2E5E0S6 | 14-259 | None |
| K6ZTG4 | 1-196 | None |
| A0A2Z6UIQ8 | 46-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.