DPCstruct | MC7348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 270 ± 34 aa |
| Standard deviation of domain lengths | 33.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 12.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840I220 | 281-546 | LRWDGMSVAGLLPYLAAGEEPPMDADDMIEVGGAELRDQKTYVNGKLATSAARTTISDIDFLGYMPQRFSAATEGVTTDYSVYFGEE… |
| A0A269PQP5 | 27-311 | QEAKIELDKQLAMINTELGVKIDYQDVSVNVLDKSFLIEKIKLVGPDGSHFADVKSVKVMGYDPQKITEYAEFKLKELVISEQLKQQ… |
| A0A2A5BK14 | 3-263 | None |
| V8C9L2 | 44-392 | None |
| A0A7V8QFB4 | 27-323 | None |
| A0A149SFR4 | 250-471 | None |
| A0A6L9MFR2 | 64-313 | None |
| A0A2K4W3K8 | 17-306 | None |
| A0A7Y7D3E0 | 144-439 | None |
| A0A1Q4FUV7 | 35-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.