DPCstruct | MC7343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 88 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W2YI17 | 2-84 | ADIKKQNYAIDPRALYVDIEEKCESCSKAFIFFAQEQQYWFEVLDFWVDSHCTRCFECRKHARYILTLRKRYDMLTSLANKTS |
| A0A431TU75 | 80-162 | GRASLGDVSRQHEHCFALPHFAYYDQEKTCRDCGRAFVFSRGEQQHWYEELQFWVEATRVRCPACSRRKHERDRLSRLLAAPD |
| D8N9M1 | 1-76 | None |
| L0DI35 | 22-104 | None |
| A0A3P1Y7K5 | 49-114 | None |
| A0A7W0FTX4 | 70-165 | None |
| A0A7Z8LCJ4 | 28-116 | None |
| A0A517M651 | 123-212 | None |
| F6G5P1 | 111-200 | None |
| A0A6C2YUY1 | 69-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.