DPCstruct | MC7341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 128 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4RL90 | 25-171 | TASRSRTWSIDTTGGITLTGYLPPWAEGDPSESDLPLEKLSVELSDLSHWQPFDGQPMRIHHPAYADGDGKAGESEEIVFNGNITCY… |
| A0A3D9NM52 | 155-266 | RTVTVQTLDRGAVTTPEPFWCVGQHPAGEFQADLAHEGEAELLLVDTRHGPVKVASACLYQRPFAEHTTRTVTVAVEFDASHEFDSA… |
| A0A1H6DK05 | 28-165 | None |
| A0A2L2MMI2 | 160-295 | None |
| A0A2L2MTR2 | 1-112 | None |
| A0A8B0DRS1 | 76-222 | None |
| D9UKA3 | 152-265 | None |
| A0A1Q4WVW3 | 88-205 | None |
| A0A3N1L9U2 | 15-147 | None |
| A0A4U0SUM4 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.