DPCstruct | MC734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 475 ± 97 aa |
| Standard deviation of domain lengths | 97.10 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.06 |
| Pfam Score | 78.79 |
| Assigned Pfam label(s) | CL0179- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4ZA99 | 395-1144 | QLRQYLSHNHGAEAAEVAFRNMQSVITQTLLVSESALAAHFGGYSANPMEGLYKCKNCFQLLGFDLIYNSSLYPMVLEVNGQPHMQV… |
| A0A672U7U9 | 24-464 | LKAQDLSVIIRAYVLVTSLTPLRAFIHSTITVWHPPKKKHFSVKVKHFISQFFHVSADSEYSNYLNSLNLIPVILYFRCSQCFQMLT… |
| G3N6B8 | 91-482 | None |
| H3ALG7 | 5-460 | None |
| A0A813AZD3 | 1-344 | None |
| A0A1W0XCB1 | 362-890 | None |
| A0A1A8AZQ3 | 71-533 | None |
| A0A401PNR5 | 63-449 | None |
| A0A6I9XFH5 | 4-478 | None |
| A0A2U9B378 | 185-646 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.