DPCstruct | MC7337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 136 ± 13 aa |
| Standard deviation of domain lengths | 12.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11284 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3NCJ1 | 1-116 | MLLFKNAVLKPVMEELQVKGGNLLFVKDEGIYLMAEKGAYLDGRRQHIAYADDFDPRLPENEDWYENAGLEVGYDDFGEFLGRDFWG… |
| A0A0U5MM33 | 2-149 | AKLIFKVADVLPLVAHSKASPSHSKGWGDDAPTPGLFLVHDQGIYLMSNGNPRQMADGSIGGEGVEGRSKVAYAEGCDPDKDAEWWD… |
| A0A7S8ELE0 | 2-134 | None |
| K0ESQ7 | 2-131 | None |
| A0A3R7EMR9 | 58-192 | None |
| A0A6N9BY91 | 1-151 | None |
| A0A2E0SE23 | 8-146 | None |
| A0A2W2FKA7 | 59-195 | None |
| Q5HY05 | 92-242 | None |
| A0A117MRB7 | 3-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.