DPCstruct | MC7335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 46.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A502DX14 | 2-76 | AGLALAGTGAAHFIHPSMWVGITEKAFPKDTDRYLKINGGLETALGLGLAVPKTRKLAIAGLLGYGAYLTVNVIR |
| A0A6G9ZF12 | 9-87 | TLRLFGLGLAGTGAAHFLAPEPFDRLTAVAFPDETRRWTLSNGATELILGLAVASRRTRLVGLAGFLAYAAFLTQRLIS |
| A0A4U0QE41 | 10-88 | None |
| A0A7X7PB01 | 1-72 | None |
| A0A318RQ01 | 38-117 | None |
| H0R5N0 | 18-98 | None |
| V8D5H4 | 12-91 | None |
| L7LB03 | 15-96 | None |
| A0A318K6G2 | 33-110 | None |
| H0QYR5 | 20-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.