DPCstruct | MC7333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 457 ± 30 aa |
| Standard deviation of domain lengths | 30.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4RXM1 | 19-523 | KSRPSQENSDGERRAVAPAITHDVQPLKTQIADAYGFVKHPNKYQWKTLPSFEGQIGKGGWAAAARLAEQFFRDNNNGATPWKHLLD… |
| A0A6G9ZDG7 | 66-484 | VQAKKMYIGQPGEPMRKLVEYRKRYVDGRLQQILKDPKFTGVSLSSPGSVNITSDYDITLVGGTNTWQAVREFNEKFRKEWGRESGT… |
| A0A6M1ZZ07 | 336-845 | None |
| A0A815KW26 | 190-654 | None |
| A0A6S7H6U6 | 94-539 | None |
| A0A815J397 | 3-465 | None |
| A0A4Q5PWH6 | 5-461 | None |
| B5VXN5 | 360-841 | None |
| A0A7K1CTN2 | 2-419 | None |
| A0A6C0ALW0 | 182-609 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.