DPCstruct | MC733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.84 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | CL0240- CL0701 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672KYN2 | 23-100 | ITSLVLGHHQPVDVCSFSSMGCLLRFGFSAMFGFGGRTLALAERHRWMPPSQRHEFALIKTLANLKPEDCELSFITSR |
| A0A1A6GC01 | 1-85 | MHIIMGHIQSVDVCTFSSAGKLLRFGFSAMFGFGGRTLALAEKYRWMSPSRRRDFAVLKALAKLQPEDCKISFLPAGCSQDEQER |
| A7RYW8 | 258-337 | None |
| A0A3Q3FG76 | 33-105 | None |
| A0A0G2JTU4 | 1-85 | None |
| G0XYG6 | 40-127 | None |
| A0A3Q2QHJ0 | 60-134 | None |
| A0A3Q0GHV0 | 181-241 | None |
| A0A556V1G8 | 26-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.