DPCstruct | MC7328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 162 ± 22 aa |
| Standard deviation of domain lengths | 22.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8RB40 | 6-130 | NSLNTTISGSETCPRCGGRAEYQAGTYDFFGDTMAAFRAPGVTRASVKAFADVVSSAARGELTHDQALEQAETINSTLATLFRTAAI… |
| A0A1H8P6B9 | 1-169 | MKTNMVHSDTQLHASCSSCGALFRSKRVRIAGNTKGIAFLNNKETCLFCGALADIQEGTFDMVNGVLRMVRDATLTRQMCSRLESLA… |
| A0A6G9ATR6 | 2-177 | None |
| A0A4R3XQH4 | 1-192 | None |
| A0A126R4F8 | 1-142 | None |
| A0A512B9U1 | 1-157 | None |
| A0A4Y4GB26 | 1-196 | None |
| A0A2A3AXL8 | 2-160 | None |
| A0A7W5VSA8 | 5-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.