DPCstruct | MC7327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8IYN9 | 1-74 | MTDRKHNHYYRLCPYPHIDVYRVLELFEVTDPALQHIIKKALCAGQRGAKDFRKDLEEIVDTGNRRIEMLDEDV |
| A0A1H9NLJ7 | 1-86 | MTRKHQHYFHSVEHLSVIDVYRICEMYVDDPSGATQHAIKKLLLPGQRGGGKGRIKDLREAADTIKRRIEMLLEDEAAEAVIAAPM |
| A0A2N1WWH2 | 3-73 | None |
| A0A496XHA0 | 1-76 | None |
| A0A2E6JZ26 | 1-73 | None |
| A0A833PFC4 | 161-227 | None |
| A0A420W5F2 | 99-172 | None |
| A0A495FY74 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.