DPCstruct | MC7325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 140 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840IZM0 | 112-251 | LAEFTSLLTSEFALRGLLRHDLDRGLAVVGTWAGHDSQDVRRLAAEGTRPLLPWAERVPRLLAEPYRTRPILDALHDDGSEYVRRSV… |
| A0A4R8WAM0 | 11-133 | SEFAIRLLLNHDMARAMPIVLGWTGSTDPAVRRLASEGTRPFLPWAIRVPAILADPTLTLPVLHALYRDEDEVVRRSVANHLNDLSR… |
| A0A2E3XQT0 | 111-266 | None |
| A0A0L0FEG9 | 296-453 | None |
| A0A3N0C8G6 | 1-132 | None |
| J9CEU1 | 260-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.