DPCstruct | MC7323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 185 ± 35 aa |
| Standard deviation of domain lengths | 34.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142CXY0 | 48-248 | TDLTSRLNLQEIDLIIDVQFVSAGEINIKSALIKEALNRINNMSEFRTIIVASNSFPENLSTYDKYRLVTIPRNESKFFNKAKQHFE… |
| A0A151ATI5 | 28-224 | SIDLIVDLGEVVQLPQDVIKSLATVICFMLTQIKASDFRNVIVAGSSFPESLNVPQNKISLLERKEWILWKEVHNKHSYVKFGDYGP… |
| A0A8A3LDX5 | 41-234 | None |
| A0A0M3AVM0 | 22-207 | None |
| A0A1S2I615 | 8-202 | None |
| T1ZC26 | 110-291 | None |
| A0A060ZKE3 | 54-251 | None |
| A0A3D2LJI7 | 201-418 | None |
| A0A559TUK2 | 7-144 | None |
| A0A3Q0L1Y4 | 4-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.