DPCstruct | MC7321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 191 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15396 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0R3M9 | 1-194 | MFGFHKPKMYRSLDGCCICRAKSSSSRFTDSKRYEKDFRSCFGLSETRSGEICNACVLLVKRWKKLPVGTKKNWNHVVDARGGPSLK… |
| A0A672R5B8 | 1-195 | MFGFHKSKIYRSNEGCCICKTKSSSSRFTDSSRYEENFRLCFGLSEDRVGDICNACVLLVKRWKKLPQGSKKNWNHVVDARAGPGFK… |
| A0A6P6II94 | 1-204 | None |
| A0A6J0WCN4 | 36-203 | None |
| A0A5N5T9D3 | 11-171 | None |
| A0A7I8VR83 | 1-199 | None |
| A0A3Q1F3P9 | 122-324 | None |
| A0A7J5Z0Q5 | 1-180 | None |
| M0RC11 | 41-245 | None |
| A0A8B6H1K9 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.