DPCstruct | MC7320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 12.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672QUH4 | 8-125 | DMQSDQSEIIVKTVKEVCAEGLIVSGGKDGIFIKDVKLESPASKHLSVKEGDQILSATVYFDNVSYEDALQILEHAQPYKVAFCLKR… |
| A0A7I8W0R7 | 140-246 | NKPTVFSVPLKSDDPWGLGFDIKGNMTKGVYISKLGNRGPAKESGKIQVGDKILSFTVSFENIVLEDALTIISYASTHPCDITLERE… |
| A0A669B4J6 | 8-126 | None |
| A0A7R9L2E9 | 72-179 | None |
| A0A4W4EBG7 | 1-109 | None |
| A0A6A4VGN7 | 154-262 | None |
| A0A7F8RVT5 | 12-138 | None |
| A0A151P1A4 | 113-244 | None |
| A0A834DIB4 | 13-143 | None |
| A0A5C6NYS9 | 105-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.