DPCstruct | MC732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0487 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672TPC2 | 23-136 | EENTESQPAVSDEYSEVPCAVNLVLRLRNSRKELNDIRFEFTPGRDTADGVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLT… |
| A0A0R3Q2P8 | 9-106 | KWLAVLRVRNQQRELNDIKFDYTRTADTVEGIAHELVTAELIDCHDLVIVAANLQKLIDFAEQKSDKRSVTFALNSGVAPNEIPDER… |
| A0A814JYE4 | 274-387 | None |
| S4R5F7 | 1-69 | None |
| A0A034VUG8 | 9-115 | None |
| A0A643BS85 | 295-429 | None |
| A0A671NJJ6 | 361-466 | None |
| A0A4Z2JG88 | 189-294 | None |
| A0A0L8IFI6 | 161-281 | None |
| A0A6J0W1Z7 | 352-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.