DPCstruct | MC7319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5NP87 | 1-86 | PVILGTIVPECWDSSSIAVMEIKKLKVGDTVSDFWDFMIYLKLSDYPKNNTLFEDLAQLFWNIYVDCTLSRAHGLGRRYIISKKYT |
| A0A672QSF0 | 1-97 | MISRELINRECWDASSLAVIQARKLRVAETVAGLWDFMTYLSGSNHPKHQDSFMELAQVFWERYVDCVLARAHGLGRRARSTTTMLK… |
| V9L9P7 | 24-115 | None |
| A0A674BE11 | 5-94 | None |
| A0A2I0UDR9 | 94-178 | None |
| A0A1V4L0C7 | 230-328 | None |
| W8Q866 | 27-100 | None |
| A0A4Z2EEB7 | 37-117 | None |
| A0A6I9Q5L7 | 36-117 | None |
| A0A4W2G535 | 38-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.