DPCstruct | MC7318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 420 ± 132 aa |
| Standard deviation of domain lengths | 131.97 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14752 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V2MFW6 | 9-252 | VEEIIDTRPALFADAEAFVDESIDDYIPKRWMVVLCAVVSLITGCFVAISLFANYIPSTVCTIMKFRSGAIPSLRDPNFIQYRKTLE… |
| A0A672QMS6 | 71-501 | SYYRDYVKKILKKKKPTKISSSASKPKLFERLRDAAKSYFYTPEDVFRFPLKLAISVVVAFIALYQMALLLVSGVLPTLHIVRRGVD… |
| A0A7S1Q3Y4 | 309-748 | None |
| A0A817MRI7 | 3-555 | None |
| A0A7M7NC93 | 146-682 | None |
| A0A2C9JN50 | 12-379 | None |
| A0A813BHX3 | 9-250 | None |
| A0A7S1VZZ0 | 12-751 | None |
| A0A7S2XQL3 | 508-1112 | None |
| S4RE41 | 44-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.