DPCstruct | MC7316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 168 ± 41 aa |
| Standard deviation of domain lengths | 41.14 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1S3E5 | 4-139 | WQVFSAVALRRLPELMPKKDPIVTKVQQIFDTLEASKSRYSQHEIQHIEDIKAKENEETDIIIRETAQDREDRWLKEKSDFKFGEYN… |
| A0A672QC42 | 24-169 | GVRNVSASRQQWSAQNVKTAGAPSPWALHGAACLQRLPVVSQDGSPIEEEFMELMHLMELERSLLSDHELRLLEDAALMSRKQEEGY… |
| H0ZDE8 | 82-189 | None |
| A0A017SIC2 | 521-749 | None |
| C5X3Z5 | 1-145 | None |
| A0A1D2N958 | 51-222 | None |
| A0A6J3BVY2 | 22-152 | None |
| A0A498NFK4 | 1-137 | None |
| A0A2G5UBR5 | 7-193 | None |
| U6LYQ0 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.