DPCstruct | MC7315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 127 ± 34 aa |
| Standard deviation of domain lengths | 33.79 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5BP61 | 22-123 | AQVKVSVDMEIAKADQRQVDGGHTPWQLDPVAVALTFVNLKVSPEGITGDPKIPEKSFKLTANNGAEAIVEVTGGPIEKVYLERLVR… |
| A0A1G1H3Z5 | 6-126 | SVLFVAGVMAFTLSPLGCGKKSEAKTSQTLKLHIDYDNESRLQLTVENGYQLWRLNPIDVAHGALTDSREMADYNACKIAQMDEKHA… |
| A0A7X9HG69 | 39-165 | None |
| A0A099S4K8 | 50-169 | None |
| A0A7C7ADL4 | 375-475 | None |
| A0A1Q7GGX8 | 21-135 | None |
| A0A7X8QFC6 | 164-266 | None |
| A0A2V9C6G8 | 1-104 | None |
| F8B6F3 | 114-312 | None |
| G2FKQ5 | 319-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.