DPCstruct | MC7313
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 104 ± 19 aa |
| Standard deviation of domain lengths | 18.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T0M6Y2 | 23-131 | RLKYLGRTPGKTSKTGEKVIEAMKKEGKIRTKKGVQQFKASDGKWYDMKYADMSHKKDAVTWWNKTGRKYGAKSEKVRKWMLDSKNY… |
| C2X0R2 | 9-108 | SKTGKEVMERMENEIPPKIRTTRDGEIEFMASDNKWYPIDQADMAHLTDAVSWWNSTGRYYGAKSPEVREWMLDSNNYVLDHYRLNR… |
| A0A1I5W4Y3 | 15-98 | None |
| A0A2S0PEJ4 | 536-647 | None |
| A0A1H0S882 | 411-521 | None |
| A0A3R6TLS0 | 4-86 | None |
| A0A826YQY3 | 40-151 | None |
| A0A553K671 | 60-176 | None |
| A0A2S3UP07 | 2-75 | None |
| A0A5S3S1S3 | 154-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.