DPCstruct | MC7312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 43 ± 4 aa |
| Standard deviation of domain lengths | 3.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8U496 | 277-317 | RVAPPAISTSPCAAGSWAADNSFYYVCISANTWKRAPVASW |
| A0A1H0HYA6 | 338-378 | ASKTPASSTAACAAGQISWDAGHIYVCVATNTWKRSALATW |
| A0A0L6J1D8 | 114-152 | None |
| A0A7W3XUN4 | 130-169 | None |
| A0A2E6H8U1 | 100-150 | None |
| A0A1I3P2E3 | 258-298 | None |
| A0A841A500 | 401-444 | None |
| A0A0Q6AK80 | 951-991 | None |
| A0A142Y9Y3 | 75-116 | None |
| A0A4Z0IGX2 | 185-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.