DPCstruct | MC7311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 53 ± 2 aa |
| Standard deviation of domain lengths | 1.61 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8JFU9 | 80-131 | LPLAVLKSNAGFYIGTFDEEGPCSRESVEYFPTKTLADKALESGDWTQKPYP |
| A0A732CHQ2 | 1-53 | MLPLQVLRSGAGYYIGTQNEEGPVSRESVEYFSTQSQAEHALKQGTWSQREQA |
| A0A5C9B6Y9 | 26-80 | None |
| A0A7X8G3G9 | 7-59 | None |
| I2IGU8 | 32-84 | None |
| A9IFT3 | 77-128 | None |
| A0A2N5L579 | 23-74 | None |
| A0A5J6Q592 | 12-64 | None |
| A0A380MHP5 | 53-107 | None |
| A0A077NTF5 | 49-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.