DPCstruct | MC7310
Metacluster Properties and Pfam Annotations
| Number of structural domains | 530 |
|---|---|
| Mean domain length (aa) | 134 ± 21 aa |
| Standard deviation of domain lengths | 21.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 96.93 |
| Assigned Pfam label(s) | CL0023- CL0072- CL0240- CL0701- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A466PBI7 | 2-117 | KRARVIYNPTSGKELIRKNLADILDVLERGGYEASAFATTAAPFSARDEARRAGEAGFDLVVAAGGDGTINEVVNGIAPLEKRPKMA… |
| A0A7N9I9V0 | 11-147 | LPRSCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDW… |
| A0A0C2JKJ3 | 50-205 | None |
| A0A1R3JZR9 | 50-197 | None |
| A0A1Y6BZ39 | 86-187 | None |
| A0A1S8VFY4 | 83-275 | None |
| A0A066VIK2 | 4-132 | None |
| A0A165ZPR2 | 233-356 | None |
| A0A6G0XRM5 | 172-285 | None |
| A0A5N6Q913 | 160-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.