DPCstruct | MC731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14926 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9DYA5 | 1-89 | MSAGDEGSERRFAFRYLPQKTLPSLENRDTQGRLRKWSMHGRITVQAFSFDQHFKAYRKDEFVKAFFNDPNVSANLKLLTASGQWTT… |
| A0A672TMK1 | 1-88 | MSAGDRRCAAGFAFRPLPQKAFPCLEDRDIRDRLLKWSMQGRITAQAFSFDQQFKPYQKDEFVTAFFNDQNVNSSLKLLSASGQWTTL |
| A0A4W2BYN8 | 1-93 | None |
| A0A7E6ERR2 | 22-102 | None |
| A0A814CHY5 | 404-494 | None |
| A0A7S4NYM8 | 5-93 | None |
| Q14BZ1 | 1-97 | None |
| R7TWN3 | 3-83 | None |
| A0A1S3QI73 | 1-94 | None |
| A0A315UV22 | 276-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.