DPCstruct | MC7309
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3TTF2 | 2-95 | QFVLEDFRSGPAWRETDEDSTDFRTLISDLLSGQYSHPIRVVALNPLVGWSRDASEDVAQELEQRVAEGFEVTEAVREFIERFTGRP… |
| A0A810AW84 | 4-95 | TVVPYGADQTLFVVIDRRDEATEIRVERSDLETTIGELVAGCFNDPIKVISFNTLEHWMKDISTDVAGEIRARCDIDGVTLPDYLSD… |
| A0A0R3MT89 | 79-190 | None |
| A0A1N6K0C5 | 6-113 | None |
| A0A1I3SPA3 | 3-98 | None |
| A0A317HAW8 | 2-97 | None |
| A0A431M8H6 | 18-115 | None |
| A0A2M8R2K1 | 64-174 | None |
| K8PAM1 | 4-82 | None |
| A0A160UJN9 | 6-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.