DPCstruct | MC7304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 13.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2GXX7 | 91-171 | GQTAPVRAGQPAAPAQPGQPAAAGTAVFPRAISPKYSAEKPAKQRMHTCLDQYNANKATNGNGGLKWIQKGGGYYSECNKR |
| A0A809ZG31 | 1-113 | MPLQYKTQRRAILAIEKGPSGADVFASAFSAWGQPVTPVESKPPAAPPVSPQTFRSPVVFPKDVSPSYSSEEPGQARMLTCRDQYVA… |
| A0A318N0R4 | 44-143 | None |
| A0A4Y6U9I5 | 7-122 | None |
| A0A1Q4BJM6 | 67-161 | None |
| J2V031 | 82-174 | None |
| A0A3A0FF57 | 17-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.