DPCstruct | MC7300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9BK05 | 23-152 | SGTDAGTETDREASDRTDPLADLAASVEGAADDRSRSSEPDFDDLFDRRDTAEIDGERLWAQLEGDDHAEMPVPVDREIREVEKRAY… |
| A0A0F7PDM0 | 3-114 | ELRRDVESKADERKATDAREYFAEMDVGDVDTDEIWADLLFEDGEPTEGQFPASGTDEKAGQVVTQGLCHRCEYFGDPPQLHCTHEG… |
| M0E7I6 | 131-254 | None |
| A0A6A9TCL6 | 94-227 | None |
| A0A2R6M2Q0 | 97-212 | None |
| A0A6B0SVB7 | 52-250 | None |
| A0A6B9F621 | 6-152 | None |
| A0A554N9Z4 | 1-149 | None |
| V4YHD2 | 214-345 | None |
| A0A285P8I5 | 47-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.