DPCstruct | MC7299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 6.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830F7D5 | 5-100 | LDSLPDRPLTTTEVAALNDADALDLALPVETEEAVRTEDDEPVEIATGVILATPGRVTGVVHDDGWTVVAAEPAGDDRTDALVACED… |
| A0A0F7PCD3 | 1-99 | MRLSSLPDRPVTQAEVAALNESDRLAMAVPVAQEDATRADDGRPVTITDQLILATDAWVVGLVYGAEWQTVERVEIDDPKTERFEAL… |
| A0A5D5APR2 | 11-114 | None |
| A0A3M9VTA2 | 3-114 | None |
| A0A498EDI0 | 7-108 | None |
| A0A2R6EQ14 | 1-99 | None |
| A0A0P7GZV3 | 2-87 | None |
| A0A2R6KP44 | 8-97 | None |
| A0A830F5E5 | 38-136 | None |
| A0A847U8L0 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.