DPCstruct | MC7298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 121 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7SQY8 | 1-90 | MIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLEWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLR… |
| A0A232F4A2 | 1-115 | MLCYLLPDVYIEFPNVALGNVQLLHLVVSTIDSLQLQDLICQILQGHLKMLKKDSLFSLLSASLNWETFEQYCLWQLIFAHDFPIEN… |
| A0A4Z2DMH5 | 933-1057 | None |
| A0A3P7LTS2 | 1-128 | None |
| A0A2I0L946 | 3-125 | None |
| A0A210PMU0 | 696-822 | None |
| T1PID2 | 226-350 | None |
| A0A6I9Z0V9 | 582-684 | None |
| A0A6P4EMV3 | 462-586 | None |
| A0A1I8IPU1 | 558-682 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.