DPCstruct | MC7297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 230 ± 24 aa |
| Standard deviation of domain lengths | 24.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7DRN1 | 57-262 | GPADKEEGNRDFWASIQEPYNYIMGSNLIPDSYQVGETAEAPSSGEFELCWDSGDVSPPYVWSFSEFLDQYNELYEWLIQVQLKLYS… |
| A0A232EYX3 | 3-204 | EQCVKNWPGPEDSKDDFWAAIRTNYDFIMDTNLIDTCKEANGELAWDEGDVSTVSWGLKEVSCQFSELYSWLRVLQELVYSKEENLL… |
| A0A6J8EWH8 | 60-300 | None |
| A0A3M7RP48 | 9-212 | None |
| A0A6J3CFR2 | 1-271 | None |
| A0A4Y2AEK0 | 1-233 | None |
| E0W3Y3 | 21-229 | None |
| A0A6J0BEB5 | 289-540 | None |
| A0A6P9A816 | 8-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.