DPCstruct | MC7296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 339 ± 39 aa |
| Standard deviation of domain lengths | 39.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.11 |
| Pfam Score | 69.64 |
| Assigned Pfam label(s) | CL0020- PF15027- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8ZNZ5 | 12-326 | QPVYCAFNCFVEKLKDTDWISHSSKEEIRNCLQSAKAIEKMLDTLETNGALDNFMALVPELHGLEWEQLRKASDIVLSMVLTAPGVS… |
| A0A232EY80 | 7-320 | KILNIIDFYCEIIENPEVLREIDINCLKKTFQACLFIENAVKKIKEEKKEIVFESHLNAWMSRKKKTIVYKCSNFKNACDKLLEFCL… |
| A0A6J0I8E7 | 55-464 | None |
| A0A4W3J8S6 | 1-264 | None |
| A0A7J5Z1J8 | 85-450 | None |
| A0A5D6XRJ4 | 7-352 | None |
| A0A444UH81 | 2-354 | None |
| A0A419PLG7 | 5-305 | None |
| A0A397W486 | 3-403 | None |
| A0A6M2D1E1 | 3-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.