DPCstruct | MC7295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 290 ± 58 aa |
| Standard deviation of domain lengths | 57.53 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 68.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00606 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9R751 | 73-290 | IVTDEELTFSLEQRAKSFICGYTLIQTEIPKLFIMESAPGMEFATNKIIDTENVDLIQYVNAKIVYAEYHIRNQIKKLYHHIRLNQC… |
| A0A232EU99 | 8-317 | TFALTSIGGTEVCGHNLICKEHPKLFVLEDLNEKKDSPIESLDIFTYVNSKFVYVERHFKNQINQMYHDLLKHKCELERQALTNAMS… |
| A0A6V7X1P5 | 620-886 | None |
| A0A2H2IT53 | 2-295 | None |
| A0A6V7WGZ5 | 796-1058 | None |
| G0PG17 | 340-656 | None |
| A0A164DF91 | 3-243 | None |
| A0A162QIX5 | 17-254 | None |
| A0A6V7TIH7 | 28-285 | None |
| K7H614 | 14-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.