DPCstruct | MC7294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 107 ± 15 aa |
| Standard deviation of domain lengths | 15.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177VC39 | 7-102 | RVSREEFVTLLGELFEKSKAEHSVYITQKPYAGDDEVAGPAVLLRVSDGRDDKDKRAKFSTIIPAAEVNEFFAQHYLPQLRASLTAA… |
| A0A232EQP0 | 2-99 | VLLENDAFLVELNKLFEKSRVAGSVSLTIKRFNGHNKPEPREGRAPLPPPTEYLCLVRAMHKSKKLSTVIHSKDVNKFQQAYWNLLK… |
| A0A1Q9CKD3 | 2-108 | None |
| A0A2T0FI96 | 13-112 | None |
| A0A3P7J887 | 12-101 | None |
| A0A137PIR4 | 1-99 | None |
| A0A5J4N395 | 1-86 | None |
| A0A165CD76 | 1-101 | None |
| A0A5B7D2R6 | 1-106 | None |
| A0A7J6PUQ7 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.