DPCstruct | MC7291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2Y3S9 | 1-79 | MLENPCRVILPQLKLITLNDENRYSPLKSIASGGIILLKDKKPGEPEQLLEPVAAGGPKKEETDEEDEPSPPEPFEFTE |
| A0A816GQ01 | 21-103 | KEKEPDSEILHNPTRVVKAQQRLISLPKGSRYQPIKDITHGGIILVKDTQSNEPETLVELAKAGGPTKEEDLPEPSPPEPFEY |
| A0A1A9Z5P2 | 1-84 | None |
| A0A6T8DEN7 | 93-174 | None |
| A0A425HYS2 | 49-137 | None |
| H2Y5H4 | 25-118 | None |
| A0A1B6JD15 | 19-110 | None |
| A0A1I7XKS9 | 77-160 | None |
| A0A0J8B3F2 | 54-135 | None |
| A0A7M7NQM7 | 252-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.