DPCstruct | MC7290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 111 ± 8 aa |
| Standard deviation of domain lengths | 7.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2Y3N9 | 1-108 | MIRTAVMYYNNKKVPAIVDLKNKPSMWHRAKSVTVPQGETEIRFDLPLPIVATNLMLEFTDFYENVSASVETLQCPRCSASVQANPG… |
| A0A077ZBI3 | 65-168 | SVRRISVYFSNHTISSAVELKRNDIWMLAREFPVTEGHSEVKMDFAVPFIARSLRIEFTLFHDKGIVEVLMCPRCSAVVRSQPGVCL… |
| A0A452V478 | 652-759 | None |
| A0A2G9RLS7 | 119-226 | None |
| A0A7R9HNL1 | 1-113 | None |
| A0A061SCK3 | 478-585 | None |
| A0A7R9DXF1 | 43-145 | None |
| A0A819QFA9 | 4-109 | None |
| A0A6I8NV14 | 1-113 | None |
| A0A368EY79 | 26-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.