DPCstruct | MC729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 194 ± 27 aa |
| Standard deviation of domain lengths | 27.00 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1JFG8 | 1-171 | MGSLKGRSPVPPLRSRSACFLRMSEGAKLDKRAERRRIVASENFNRRGFGETKEEVQGMMVEEFTSDMVKELKENNNVIERNNVVIK… |
| A0A2J6JKJ7 | 1-190 | MASLRFSPFSTGTGLSPPNVRITRCPKPLFVRCTNGDASSPSMADSSDFDAKVFRHNLTRSDNYNRKGFGRKEETLDLMNQEYTSDI… |
| A0A4D9C086 | 2-174 | None |
| A0A448Z7X1 | 1-193 | None |
| A0A7J6SFA5 | 3-154 | None |
| A0A7S4MRC8 | 15-246 | None |
| A0A813A5R7 | 361-543 | None |
| A0A2G2YNX1 | 1-194 | None |
| A0A834HAB8 | 55-211 | None |
| A0A7J6NNP0 | 47-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.