DPCstruct | MC7289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 170 ± 26 aa |
| Standard deviation of domain lengths | 26.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7FPR1 | 258-396 | VSPEQCCSYYSMLVAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFISAMKGKCLLEVTGVADPTGCGEGFSYV… |
| H2Y332 | 4-169 | MVSPEQTCSFYSMIAAEQRLKDAGYGEKTMLYQPEDDNEEEHQLKVDEEVLNAPWNTTRAFLSAIKGKCLLQVTGPADPTGCGEGFS… |
| A0A7R9KSS5 | 644-822 | None |
| A0A813UCJ3 | 394-546 | None |
| R1BWK4 | 312-509 | None |
| A0A3P7YRT5 | 1-154 | None |
| A0A4Y2LWS0 | 624-787 | None |
| D8RD05 | 990-1135 | None |
| A0A3P7HJ19 | 28-201 | None |
| A0A7J5ZS26 | 23-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.