DPCstruct | MC7287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 178 ± 17 aa |
| Standard deviation of domain lengths | 17.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08729 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2Y080 | 2-176 | DLLYAEPPSKKTPKEPKPSVRLEVSLSSQSDATVTEVSYAALLQGSVKKTKQSEKNGVDLDNPAKSDAESLARYYEAKYGGGGAGSG… |
| A0A7M3R8Y0 | 2-145 | ADRTIVLDINILDNEEPNDFSYLDLVESKLASAGGTQRPGEDEDSKIAEIAKSLEKKYGQMVTISKKGKRRRIRVDDFIDPGEGYDS… |
| A0A4Z2B1D7 | 1-195 | None |
| E1B7L7 | 92-276 | None |
| H3BXS2 | 2-154 | None |
| A0A3P7FGP0 | 6-171 | None |
| A0A267E7B3 | 29-245 | None |
| A0A6A4WQ01 | 1-177 | None |
| A0A833S1Y0 | 1-171 | None |
| H3CS34 | 10-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.