DPCstruct | MC7286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 222 ± 19 aa |
| Standard deviation of domain lengths | 19.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14837 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2XZK3 | 1-248 | MPVSTGMPANAKPQQSSKQHGALQMVHWFVASCYTSGSFTEERVQSSVMLLRRVPASRHAVLHRFSALFEEAVRLHLDHMEYQASAQ… |
| A0A1Y3EW53 | 3-237 | SRVELRIIRRFLYVASSMPDIHGISSRWASVALRDMILPTVYLMEHLVSYRHAVLDFLSSLIHENLLFDIFQIRCAHFALPQTRGHT… |
| A0A2H2J5E6 | 1-237 | None |
| A0A5E4R5K5 | 1-188 | None |
| A0A815GXL8 | 1-214 | None |
| A0A2R7WP54 | 1-232 | None |
| A0A0K8UHP3 | 6-231 | None |
| A0A226M7B9 | 2-192 | None |
| A0A2T7NL80 | 5-233 | None |
| A0A3M7P7U3 | 1-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.